Cat: PA1000-681DB

Recombinant Human COMMD9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COMMD9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COMMD9;COMM domain-containing Protein 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9P000

  • Expression Region

    1-198aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAALTAEHFAALQSLLKASSKDVVRQL CQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLS SAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLD WRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKET LDTMLDGLGRIRDQLSAVASK

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COMMD9 is a member of the COMM domain-containing proteins, which are implicated in various cellular processes including protein quality control, endosomal trafficking, and the regulation of the NF-κB signaling pathway. The study of COMMD9 has garnered significant interest due to its potential role in modulating immune responses and its association with various diseases, including certain cancers and inflammatory disorders. Researchers have focused on the characterization of COMMD9 recombinant proteins to better understand their structural properties and functional mechanisms. The production of recombinant COMMD9 proteins allows for detailed biochemical analyses, including studies on protein interactions and post-translational modifications. These investigations are crucial for elucidating the biological roles of COMMD9 in cellular pathways and its potential as a therapeutic target. Understanding the function of COMMD9 and its interactions can provide insights into its contribution to disease pathogenesis and the development of novel treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US