Analytical Data
-
Gene name
CLU
- Application
-
Alternative Names
CLU;Clusterin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10909
-
Expression Region
23-449aa
-
AA Sequence
DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
-
Molecular Weight
52.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLU (Clusterin) is a glycoprotein that plays a crucial role in various physiological and pathological processes, including cellular stress responses, apoptosis, and lipid transport. Originally identified as a potential apoptosis regulator, CLU is now recognized for its involvement in neurodegenerative diseases, cancer, and immune responses. The protein exists in two main isoforms: the secreted form, which is widely studied for its role in extracellular functions, and the nuclear form, which is implicated in regulating gene expression and cell survival. Research has shown that altered levels of CLU are associated with conditions such as Alzheimer's disease, where its expression can reflect neuroinflammatory states and amyloid pathology. Additionally, CLU's dysregulation in cancer is linked to tumor progression, metastasis, and resistance to therapy. Recent studies have focused on elucidating the molecular mechanisms underlying CLU's diverse functions, aiming to understand its potential as a biomarker for various diseases and as a therapeutic target. The continuing exploration of CLU's roles in different biological contexts promises to unveil novel insights into its contributions to disease mechanisms and offer opportunities for innovative treatment strategies.
