Analytical Data
-
Gene name
DSP
- Application
-
Alternative Names
DSP；BEDP；DUSP13；MDSP；Dual specificity Protein phosphatase 13A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15924
-
Expression Region
78-300aa
-
AA Sequence
CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of DSP (Downstream Processing) recombinant proteins has gained significant attention in recent years due to the increasing demand for therapeutic proteins in biotechnology and pharmaceutical industries. Recombinant proteins, produced through genetic engineering techniques, are pivotal in developing biological drugs, vaccines, and diagnostic tools. However, their production often involves complex upstream processes, followed by the need for efficient downstream processing to ensure purity, activity, and stability. Challenges such as solubility, yield, and post-translational modifications necessitate innovative approaches in purification and formulation. Furthermore, the rise of personalized medicine and biopharmaceutical innovations amplifies the importance of optimizing DSP for producing high-quality recombinant proteins. Research in this area focuses on enhancing yield through improved expression systems, developing novel purification techniques, and designing formulations that maintain protein integrity. Addressing these challenges is critical for reducing costs, improving patient access to biopharmaceuticals, and accelerating the drug development pipeline, ultimately enhancing therapeutic outcomes for various diseases. Thus, the exploration of DSP methodologies represents a crucial frontier in biotechnology, aimed at meeting the growing global healthcare needs.
