Analytical Data
-
Gene name
CLEC2D
- Application
-
Alternative Names
CLEC2D；CLAX；LLT1；OCIL；C-type lectin domain family 2 member D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHP7
-
Expression Region
1-154aa
-
AA Sequence
MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVC GMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQ RFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTE WTRQ
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC2D, a member of the C-type lectin-like receptor family, plays a crucial role in the immune system, particularly in mediating interactions between immune cells and pathogens. Research into CLEC2D has gained momentum due to its potential involvement in various physiological and pathological processes, including infection, inflammation, and autoimmunity. As a receptor that can recognize specific carbohydrate structures on pathogens, CLEC2D is believed to participate in pathogen recognition and the modulation of immune responses. Recent studies have also indicated that CLEC2D might have implications in cancer biology, potentially influencing tumor immunity and progression. Understanding the structural and functional properties of CLEC2D is vital for elucidating its role in these biological contexts and could pave the way for novel therapeutic strategies targeting immune modulation. Advances in structural biology techniques, such as X-ray crystallography and cryo-electron microscopy, have contributed to mapping the complex structure of CLEC2D, facilitating insights into its ligand interactions and downstream signaling pathways. Given the increasing recognition of the importance of innate immune receptors in health and disease, further investigations into CLEC2D could provide valuable information for designing innovative treatments for various immune-related conditions.
