Analytical Data
-
Gene name
EP3
- Application
-
Alternative Names
EP3;FAM12B;HE3B;Epididymal secretory Protein E3-beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43115
-
Expression Region
1-53aa
-
AA Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
-
Molecular Weight
12.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EP3 receptor, a subtype of the prostaglandin E receptor family, plays a crucial role in various physiological and pathological processes, including inflammation, pain modulation, and neural signaling. Its significance has drawn considerable attention in recent years, particularly in the context of pain management and potential therapeutic applications. The EP3 receptor is involved in the transmission of pain signals and has been implicated in conditions such as arthritis and neuropathic pain. Given the complexity of its signaling pathways and the wide range of biological effects mediated by prostaglandins, researchers have focused on generating recombinant EP3 proteins to better understand its structure and function. Such studies aim to elucidate the receptor's molecular mechanisms, facilitating the identification of novel drug targets and developing more effective treatments. The recombinant EP3 proteins produced in various expression systems allow for detailed biochemical and biophysical characterization, enabling high-throughput screening of small molecules and antibodies. Additionally, these proteins are essential for studying receptor pharmacology and the development of biased agonists that might provide therapeutic benefits with fewer side effects. As the understanding of EP3 signaling expands, it holds promise for advancing pain relief strategies and addressing other associated disorders, making the investigation of EP3 recombinant proteins a key focus in pharmacological research.











