Analytical Data
-
Gene name
PTGES
- Application
-
Alternative Names
PTGES；MGST1L1；MPGES1；PGES；Prostaglandin E synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14684
-
Expression Region
1-152aa
-
AA Sequence
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
-
Molecular Weight
17.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTGES (Prostaglandin E Synthase) is a crucial enzyme involved in the biosynthesis of prostaglandin E2 (PGE2), a lipid mediator that plays diverse roles in inflammation, pain, and cancer progression. The study of PTGES has gained significant attention due to its pivotal role in various physiological and pathological processes, including its involvement in immune responses and tumorigenesis. PTGES exists in multiple isoforms, primarily PTGES-1, PTGES-2, and PTGES-3, each with distinct regulatory mechanisms and tissue-specific functions. Understanding the structural and functional characteristics of these isoforms is critical for developing targeted therapies for inflammatory diseases and cancers. Recent advancements in recombinant protein technology have enabled researchers to produce and purify PTGES isoforms, paving the way for detailed biochemical and biophysical studies. This research focuses on elucidating the catalytic mechanisms, substrate specificity, and regulatory interactions of PTGES, providing insights into how modulation of its activity can influence disease outcomes. Additionally, the exploration of PTGES as a therapeutic target is underscored by its potential to alter PGE2 levels, thereby affecting tumor microenvironments and immune responses. Overall, the research on recombinant PTGES proteins represents a promising avenue for both basic scientific investigation and clinical therapeutic development, contributing to the broader understanding of prostaglandin biology and its implications in health and disease.
