Cat: PA1000-9322

Recombinant Human Grb10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Grb10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Grb10;GRBIR;KIAA0207;Growth factor receptor-bound Protein 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13322-3

  • Expression Region

    1-536aa

  • AA Sequence

    MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQR VQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGS LPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS WTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNP MNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWK KLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPT DHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEE GHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIK QQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLD DGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

  • Molecular Weight

    87 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Grb10 (Growth factor receptor-bound protein 10) is an adaptor protein that plays a significant role in various cellular processes, including growth, metabolism, and signal transduction. Research into Grb10 has gained momentum because of its involvement in insulin signaling pathways and its potential implications in metabolic disorders like obesity and type 2 diabetes. Furthermore, Grb10 has been shown to interact with various receptor tyrosine kinases, which are crucial for cell signaling in response to growth factors. The interest in Grb10 is also fueled by its unique regulatory functions, particularly in the context of imprinted genes and their effects on developmental biology. The study of Grb10 recombinant proteins is vital for elucidating its structural and functional characteristics, providing insights into its molecular mechanisms. By producing and analyzing recombinant Grb10, researchers aim to uncover its detailed role in cellular signaling and its potential as a therapeutic target. Moreover, understanding the dynamics of Grb10's interactions can open avenues for novel drug developments aimed at treating metabolic diseases and conditions related to aberrant signaling pathways. Overall, Grb10's intricate involvement in essential biological processes renders it a key focus in both basic and translational research, underscoring the necessity for further studies on its recombinant forms to fully exploit its potential in biomedical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US