Analytical Data
-
Gene name
CETN2
- Application
-
Alternative Names
CETN2；CALT；CEN2；Centrin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41208
-
Expression Region
1-172aa
-
AA Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
-
Molecular Weight
35.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CETN2, or cetn2, is a gene that encodes for the neural-specific protein known as centrins. It is part of a larger family of centrin proteins that play crucial roles in cellular processes, including cell division, signaling, and the maintenance of cellular structure. Research on CETN2 has gained significant interest due to its involvement in various biological functions and its potential implications in diseases such as cancer, neurodegenerative disorders, and ciliopathies. Studies have shown that CETN2 is essential for the formation and stabilization of centrioles and cilia, organelles that are vital for proper cellular signaling and mechanosensation. The aberrant expression of CETN2 has been associated with disruptions in ciliary function, which can contribute to developmental defects and disease phenotypes. Given the importance of CETN2 in maintaining cellular integrity and function, understanding its structure and function could provide insights into its role in health and disease. Recent advances in recombinant protein technology have facilitated the production of CETN2, enabling researchers to investigate its biochemical properties, interactions with other proteins, and its potential as a therapeutic target. Thus, studying CETN2 as a recombinant protein not only deepens our understanding of its fundamental biology but also opens avenues for novel therapeutic strategies that could mitigate diseases linked to ciliary dysfunction and centrin-related pathways.
