Cat: PA1000-9235

Recombinant Human DUSP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DUSP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DUSP1;CL100;MKP1;PTPN10;Dual specificity Protein phosphatase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28562

  • Expression Region

    1-367aa

  • AA Sequence

    MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRR RAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGA LCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCS SCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICL AYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSP AMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

  • Molecular Weight

    42.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Dual-specificity phosphatase 1 (DUSP1), also known as mitogen-activated protein kinase phosphatase 1 (MKP-1), is a critical enzyme that plays a pivotal role in regulating cellular responses to stress and inflammation. By dephosphorylating both tyrosine and serine/threonine residues, DUSP1 modulates key signaling pathways, including those mediated by mitogen-activated protein kinases (MAPKs) such as ERK, JNK, and p38 MAPK. Dysregulation of DUSP1 has been implicated in various pathological conditions, including cancer, cardiovascular diseases, and autoimmune disorders. The interest in DUSP1 is driven by its potential as a therapeutic target; understanding its structure and function can reveal mechanisms underlying disease progression and treatment resistance. Recent advancements in recombinant protein technology have facilitated the production of DUSP1, allowing for in-depth studies on its biochemical properties, interaction with substrates, and regulatory mechanisms. These studies not only enhance our understanding of DUSP1's role in cellular signaling but also pave the way for the development of pharmacological inhibitors or activators that could modulate its activity for therapeutic benefit. Consequently, research on DUSP1 recombinant protein has become a compelling area of exploration, bridging basic science and clinical applications while offering insights into the fine-tuning of signaling pathways involved in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US