Analytical Data
-
Gene name
CA1
- Application
-
Alternative Names
CA1；COLL6；Collagen alpha-1(XI) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00915
-
Expression Region
2-261aa
-
AA Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
-
Molecular Weight
30.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA1, or carbonic anhydrase I, is an enzyme that plays a crucial role in the regulation of pH and carbon dioxide homeostasis in various biological systems. As a member of the carbonic anhydrase family, CA1 catalyzes the reversible reaction between carbon dioxide and water to produce bicarbonate and protons, thus facilitating gas exchange and acid-base balance in tissues. Research on CA1 recombinant protein has gained significance due to its potential applications in medical and industrial fields. Understanding the structure and function of CA1 through recombinant techniques enables scientists to explore its therapeutic targets, including its role in metabolic disorders, cancer, and respiratory diseases. The recombinant production of CA1 allows for higher yields and purity compared to traditional extraction methods, making it easier to study enzyme kinetics and inhibitors. Additionally, engineering CA1 for improved stability and catalytic efficiency could enhance its application in biotechnological processes, such as carbon capture and sequestration. Overall, the study of CA1 recombinant protein not only contributes to our fundamental understanding of enzyme mechanisms but also holds promise for innovative solutions in health and environmental challenges.
