Analytical Data
-
Gene name
CA125
- Application
-
Alternative Names
CA125；CA125；Mucin-16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXI7
-
Expression Region
12660-12923aa
-
AA Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
-
Molecular Weight
58.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA125, also known as cancer antigen 125, is a glycoprotein that is predominantly expressed in ovarian cancer cells but can also be found in normal tissues such as the endometrium and tissue fluids. The elevation of CA125 levels in the blood is commonly associated with ovarian malignancies, making it a significant biomarker for diagnosis, monitoring treatment response, and assessing disease recurrence. Research into the recombinant protein form of CA125 aims to improve its utility in clinical applications, including diagnostic assays and therapeutic interventions. By using recombinant DNA technology, scientists can produce CA125 in a controlled environment, allowing for the generation of highly pure and functional proteins. This has potential implications for the development of more sensitive and specific diagnostic tests, as well as therapeutic vaccines that could induce an immune response against CA125-expressing tumors. Furthermore, the understanding of CA125's structure and function through recombinant protein studies can provide insights into its role in cancer biology and enhance the potential for targeted therapies, ultimately improving patient outcomes in ovarian cancer management.
