Analytical Data
-
Gene name
BEX1
- Application
-
Alternative Names
BEX1；Protein BEX1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBH7
-
Expression Region
1-125aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMESKEKRAVNSLSMENANQENEEKEQV ANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARM REENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BEX1, or Brain Expressed X-linked 1, is a gene located on the X chromosome that encodes a protein involved in various cellular processes, including apoptosis, neurogenesis, and modulation of neuronal activity. Research on BEX1 has garnered attention due to its potential implications in neurological disorders and brain function, as it is primarily expressed in the brain and other neural tissues. Studies have suggested that BEX1 may play a role in regulating synaptic plasticity and neuronal signaling pathways, making it a candidate for investigating mechanisms related to cognitive functions and neurodevelopment. Additionally, abnormalities in BEX1 expression have been linked to conditions such as intellectual disabilities and autism spectrum disorders. The recombinant expression of BEX1 in various heterologous systems allows researchers to obtain sufficient amounts of the protein for structural and functional analyses, facilitating the exploration of its biological roles. Understanding BEX1's structure and function at the molecular level could provide insights into its involvement in neurodevelopmental processes and its potential as a therapeutic target in neurological diseases. As such, BEX1 recombinant protein research is crucial for elucidating the protein's mechanisms and developing strategies for intervention in associated disorders.
