Analytical Data
-
Gene name
ATP5O
- Application
-
Alternative Names
ATP5O；ATP5O；ATPO；ATP synthase subunit O. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48047
-
Expression Region
24-213aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMFAKLVRPPVQVYGIEGRYATALYSAASKQ NKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFS PLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEA TLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKI QKLGRAMREIV
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP5O, also known as subunit O of ATP synthase, is a crucial component of the mitochondrial ATP synthase complex, which plays a vital role in cellular energy production through oxidative phosphorylation. Research into the ATP5O protein has gained significant attention due to its essential function in ATP synthesis and its implications in various metabolic diseases and mitochondrial dysfunctions. Defects in ATP synthase can lead to a range of health issues, including neurodegenerative diseases, metabolic disorders, and myopathies, highlighting the importance of understanding its molecular structure and function. By using recombinant DNA technology, scientists can produce ATP5O in vitro, allowing for detailed studies of its biochemical properties, interactions with other subunits, and the impact of specific mutations. This research not only helps elucidate the intricacies of mitochondrial bioenergetics but also paves the way for potential therapeutic strategies aimed at correcting ATP5O-related dysfunctions or providing insights into the development of new drugs. Furthermore, as mitochondrial dysfunction is increasingly recognized as a key player in aging and a variety of diseases, ATP5O remains a target of interest for researchers aiming to unlock new avenues in biological research and medicine. Thus, the study of recombinant ATP5O protein serves as a pivotal step in advancing our understanding of mitochondrial mechanisms and addressing associated health challenges.
