Analytical Data
-
Gene name
ASB13
- Application
-
Alternative Names
ASB13；Ankyrin repeat and SOCS box Protein 13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXK3
-
Expression Region
1-278aa
-
AA Sequence
MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLI ESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPL CDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDV GANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHA AKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTP LTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASB13 (Ankyrin Repeat and SOCS Box-Containing 13) is a member of the ASB family of proteins, which are characterized by the presence of ankyrin repeats and a SOCS box. These proteins play critical roles in various cellular processes, including signal transduction, protein degradation, and immune response regulation. Research into ASB13 has gained attention due to its potential involvement in modulating cellular pathways associated with viral infections, inflammation, and cancer. Studies have shown that ASB13 can interact with various signaling molecules and transcription factors, suggesting its role as a regulator of key biological processes. Furthermore, the understanding of ASB13 is crucial for uncovering its function as a potential biomarker or therapeutic target in diseases characterized by dysregulated protein interactions and signaling pathways. The recombinant production of ASB13 protein allows for detailed structural and functional analyses, facilitating investigations into its biological mechanisms. This research aims to elucidate the molecular functions of ASB13, contributing to the broader field of protein biology and its implications in health and disease. By exploring the intricate networks in which ASB13 operates, scientists hope to unveil novel insights into the development of therapeutic strategies against conditions linked to ASB13 dysregulation. Overall, the study of ASB13 recombinant protein not only enhances our understanding of its biological role but also opens new avenues for research in targeted therapies and biomarker discovery.
