Analytical Data
-
Gene name
CYP2C9
- Application
-
Alternative Names
CYP2C9；CYP2C10；Cytochrome P450 2C9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11712
-
Expression Region
1-162aa
-
AA Sequence
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG
-
Molecular Weight
25.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP2C9 is a critical enzyme belonging to the cytochrome P450 superfamily, primarily responsible for the metabolism of various clinically significant drugs, including anticoagulants, nonsteroidal anti-inflammatory drugs, and anticonvulsants. Variations in the CYP2C9 gene can lead to polymorphisms that affect enzyme activity, resulting in altered drug clearance and varying patient responses to medications. This variability can influence therapeutic outcomes and increase the risk of adverse drug reactions, making CYP2C9 an important focus in pharmacogenetic research. The expression of recombinant CYP2C9 proteins provides a valuable tool for studying enzyme kinetics, substrate specificity, and drug interactions in vitro. The use of recombinant technology allows for the production of isoforms with specific mutations, enabling a deeper understanding of how genetic variants impact enzyme function. Additionally, insights gained from CYP2C9 research have implications for personalized medicine, allowing healthcare providers to tailor drug therapies based on a patient’s genetic profile, thus optimizing efficacy and minimizing the risk of toxicity. Given the rising emphasis on precision medicine, studies surrounding CYP2C9 recombinant proteins are increasingly relevant, as they pave the way for improved drug development and individualized treatment strategies that can significantly enhance patient care.
