Cat: PA1000-208DB

Recombinant Human ARF5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARF5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARF5;ADP-ribosylation factor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P84085

  • Expression Region

    全长

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGLTVSALFSRIFGKKQMRILMVGLDAAGK TTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDM PNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARF5 (ADP-ribosylation factor 5) is a member of the ARF family of small GTPases that play critical roles in membrane trafficking, cytoskeletal dynamics, and cellular signaling. As part of the ARF superfamily, ARF5 is particularly involved in the regulation of vesicle formation and transport within the cell. Research has shown that ARF5 is essential for endosomal and Golgi function, influencing processes like receptor recycling and lipid metabolism. Alterations in ARF5 activity have been implicated in various diseases, including cancer and neurodegenerative disorders, where its regulatory functions become disrupted. The recombinant expression of ARF5 protein has become an important area of study, allowing scientists to investigate its biochemical properties, interactions with other cellular proteins, and its role in distinct signaling pathways. By understanding the structure-function relationship of ARF5 through recombinant technology, researchers aim to unravel its potential as a therapeutic target and to elucidate its contributions to normal and pathological cellular processes. In summary, the investigation of ARF5 recombinant proteins provides invaluable insights into the molecular mechanisms underlying cellular function and disease pathology, paving the way for the development of innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US