Cat: PA1000-9001

Recombinant Human WNT5A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WNT5A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WNT5A;Protein Wnt-5a

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P41221

  • Expression Region

    62-380aa

  • AA Sequence

    MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELS TCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WNT5A is a member of the Wnt signaling pathway, which plays a critical role in various biological processes, including cell proliferation, differentiation, and tissue development. Abnormalities in WNT5A signaling have been implicated in numerous diseases, particularly in cancer and developmental disorders. Research on WNT5A recombinant protein has garnered interest due to its potential therapeutic applications, especially in regenerative medicine and oncology. Understanding the structural and functional aspects of WNT5A is crucial, as it is involved in regulating non-canonical Wnt pathways, influencing cell migration and polarity. Experimental studies with recombinant WNT5A protein offer insights into its signaling mechanisms and biological effects on target cells. Furthermore, as WNT5A has been shown to affect cellular responses in various contexts, including immune modulation and tumor microenvironments, characterizing its activity could provide novel strategies for targeted therapies. The quest to harness WNT5A’s biological properties underscores its significance in advancing both basic science and clinical applications, making it a focal point for ongoing research initiatives.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US