Cat: IPD-X12232

Recombinant Human FGFR-3 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGFR-3

  • 简介

    The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (HEK293, His) is the recombinant human-derived FGFR-3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH-3T3 mouse fibroblast cells. The IC50 for this effect is 2.53 ng/mL, corresponding to a specific activity is 3.95×10^5 U/mg. Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH-3T3 mouse fibroblast cells. The IC50 for this effect is 2.53 ng/mL, corresponding to a specific activity is 3.95×105 U/mg.

  • Alternative Names

    Fibroblast growth factor receptor 3; FGFR-3; CD333; JTK4

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22607-1

  • Expression Region

    E23-G375

  • AA Sequence

    ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    60-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast Growth Factor Receptor 3 (FGFR3) is a critical receptor involved in various developmental processes, particularly in bone growth and differentiation. Mutations in the FGFR3 gene are associated with several skeletal disorders, including achondroplasia and hypochondroplasia, which lead to disproportionate short stature. In cancer research, aberrant FGFR3 signaling has been implicated in the progression of certain tumors, notably bladder cancer and multiple myeloma, making FGFR3 a potential therapeutic target. Recombinant FGFR3 proteins have become increasingly important for understanding the receptor's biological functions, interactions with ligands, and its role in disease mechanisms. The production of these recombinant proteins facilitates the study of FGFR3's structure-function relationships, helps to identify small molecules or antibodies that can modulate its activity, and supports the development of novel therapeutic strategies aimed at treating FGFR3-related disorders. Advances in molecular cloning and expression systems have enabled researchers to produce high-purity FGFR3 proteins, allowing for detailed functional assays and structural analyses. Such studies are essential not only for elucidating the pathways regulated by FGFR3 but also for the design of targeted drugs that can effectively inhibit or activate this receptor, thereby offering hope for improved treatment options for patients with FGFR3-associated conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US