Cat: PA1000-191DB

Recombinant Human APMAP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APMAP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APMAP;C20orf3;Adipocyte plasma membrane-associated Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HDC9

  • Expression Region

    1-416aa

  • AA Sequence

    MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSL TVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLV GPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCG RPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFV NDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVK VLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVEN MPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFS QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL GSFRSPFLCRLSLQAV

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APMAP (Adipocyte Plasma Membrane-Associated Protein) is a membrane-associated protein that has garnered attention in recent years due to its potential role in obesity and metabolic disorders. It is primarily expressed in adipose tissue, where it is believed to function in the regulation of lipid metabolism and insulin sensitivity. Studies suggest that APMAP may play a crucial role in the modulation of adipocyte function, influencing processes such as fat storage and release. Given the global rise in obesity and related health issues, understanding APMAP's structural and functional characteristics is essential for uncovering its mechanisms of action. Researchers have focused on the recombinant expression of APMAP to investigate its biological functions and interactome, utilizing various expression systems to produce active protein for biochemical assays. These studies aim to elucidate the pathways in which APMAP is involved, including its interactions with other cellular proteins and lipids. Furthermore, the exploration of APMAP's role in adipocyte differentiation and metabolic signaling pathways may provide insights into novel therapeutic targets for treating obesity and its associated disorders. As the scientific community continues to explore the complex interactions within metabolic pathways, APMAP stands out as a significant factor that could inform future research and interventions aimed at improving metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US