Analytical Data
-
Gene name
AGTR1
- Application
-
Alternative Names
AGTR1;AGTR1A;AGTR1B;AT2R1;Type-1 angiotensin II receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30556
-
Expression Region
306-356aa
-
AA Sequence
LFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCF
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The angiotensin II type 1 receptor (AGTR1) is a key component of the renin-angiotensin system (RAS), which regulates blood pressure, fluid balance, and cardiovascular homeostasis. Dysregulation of AGTR1 is implicated in various pathologies, including hypertension, heart failure, and kidney diseases. The receptor's structure and function have attracted significant research attention, particularly concerning its role in mediating the effects of angiotensin II, a potent vasoactive peptide. Given the receptor's involvement in critical physiological processes and its potential as a therapeutic target, the generation of recombinant AGTR1 protein aids in elucidating the receptor's signaling mechanisms, ligand-binding properties, and interactions with downstream effectors. The study of AGTR1 through recombinant protein approaches enables the development of novel pharmacological agents aimed at modulating its activity, thus offering insights into new treatment strategies for RAS-related disorders. This research provides a foundation for understanding how AGTR1 contributes to disease mechanisms and informs the design of selective AGTR1 antagonists or modulators that could improve clinical outcomes for patients with cardiovascular and renal diseases.











