Analytical Data
-
Gene name
VIP
- Application
-
Alternative Names
VIP；VIP peptides
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01282
-
Expression Region
1-169aa
-
AA Sequence
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPD QVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAK KYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSIL NGKRSSEGESPDFPEELEK
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VIP (Vasoactive Intestinal Peptide) is a neuropeptide with diverse physiological roles, particularly in the regulation of circadian rhythms, neurotransmission, and immune responses. Recent research has highlighted its potential therapeutic applications in various medical conditions, including neurodegenerative diseases, metabolic disorders, and inflammatory processes. The interest in VIP recombinant proteins has surged due to their ability to mimic the activity of endogenous VIP and to serve as tools for exploring VIP signaling pathways. Advanced biotechnological methods, such as recombinant DNA technology, have enabled the production of VIP in vast quantities, facilitating both in vitro and in vivo studies. Additionally, the unique properties of VIP as a pleiotropic signaling molecule make it a valuable candidate for drug development and for understanding the complexities of cell signaling mechanisms in health and disease. Ongoing studies aim to elucidate the precise mechanisms of VIP action and its potential as a therapeutic agent, reinforcing the significance of VIP recombinant proteins in translational research and clinical applications.
