Analytical Data
-
Gene name
AK1
- Application
-
Alternative Names
AK1；Aldo-keto reductase family 1 member B15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00568
-
Expression Region
1-194aa
-
AA Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
-
Molecular Weight
37.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AK1 (Adenylate Kinase 1) is an essential enzyme involved in cellular energy homeostasis, playing a critical role in the transfer of phosphate groups in the ATP-ADP cycle. The significance of AK1 has been underscored in various research studies focusing on its involvement in energy metabolism, cellular stress responses, and apoptosis. Dysregulation of AK1 has been associated with several pathological conditions, including cancer and neurodegenerative diseases, where altered energy balance contributes to disease progression. Moreover, AK1 is also significant in certain parasitic organisms, making it a potential target for therapeutic interventions. Recent advancements in recombinant protein technology have enabled the production of AK1 in heterologous systems, allowing for detailed characterization of its enzymatic activity, structural properties, and interaction with other cellular components. Understanding the structure-function relationship of AK1 at the molecular level provides insights into its mechanisms of action and opens avenues for the development of AK1-targeted drugs or therapeutic strategies. As research continues to unveil the multifaceted roles of AK1, it holds promise as a crucial player in both basic biology and therapeutic development.
