Analytical Data
-
Gene name
AIP
- Application
-
Alternative Names
AIP;XAP2;AH receptor-interacting Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00170
-
Expression Region
1-330aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHPVWETIVCTMREGEIAQFLCDIKHVVLYPL VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF HMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAA KYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEV MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVL DDSRARGKPMELIIGKKFKLLDHCSSILNKYDDNVKAYFKRGKAHAAVWN AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AIP (Apoptosis-Inhibiting Protein) is a key player in the regulation of apoptotic processes and has garnered significant interest in the field of molecular and cellular biology. The study of AIP and its recombinant protein forms is rooted in the understanding that apoptosis, or programmed cell death, is crucial for maintaining cellular homeostasis and proper organism development. Dysregulation of apoptotic pathways has been implicated in a variety of diseases, including cancer, neurodegenerative disorders, and autoimmune conditions, making AIP a prominent target for therapeutic interventions. Researchers have focused on isolating and characterizing the recombinant forms of AIP to explore their structural and functional properties. By employing techniques such as recombinant DNA technology, scientists can produce AIP in host systems like bacteria or yeast, facilitating large-scale production and detailed biochemical studies. Furthermore, understanding AIP’s interactions with other apoptotic regulators and signaling pathways can provide insights into its role in disease mechanisms and therapeutic strategies. The exploration of AIP recombinant proteins also opens pathways for the development of novel drugs or biological agents that can modulate apoptosis, offering potential avenues for treatment in various pathologies where apoptotic regulation is compromised. As research progresses, the manipulation of AIP through recombinant technology continues to highlight its importance in both fundamental biology and clinical applications, underscoring the necessity of understanding protein behavior in therapeutic contexts.











