Cat: PA1000-99DB

Recombinant Human AIP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AIP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AIP;XAP2;AH receptor-interacting Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00170

  • Expression Region

    1-330aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHPVWETIVCTMREGEIAQFLCDIKHVVLYPL VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF HMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAA KYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEV MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVL DDSRARGKPMELIIGKKFKLLDHCSSILNKYDDNVKAYFKRGKAHAAVWN AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AIP (Apoptosis-Inhibiting Protein) is a key player in the regulation of apoptotic processes and has garnered significant interest in the field of molecular and cellular biology. The study of AIP and its recombinant protein forms is rooted in the understanding that apoptosis, or programmed cell death, is crucial for maintaining cellular homeostasis and proper organism development. Dysregulation of apoptotic pathways has been implicated in a variety of diseases, including cancer, neurodegenerative disorders, and autoimmune conditions, making AIP a prominent target for therapeutic interventions. Researchers have focused on isolating and characterizing the recombinant forms of AIP to explore their structural and functional properties. By employing techniques such as recombinant DNA technology, scientists can produce AIP in host systems like bacteria or yeast, facilitating large-scale production and detailed biochemical studies. Furthermore, understanding AIP’s interactions with other apoptotic regulators and signaling pathways can provide insights into its role in disease mechanisms and therapeutic strategies. The exploration of AIP recombinant proteins also opens pathways for the development of novel drugs or biological agents that can modulate apoptosis, offering potential avenues for treatment in various pathologies where apoptotic regulation is compromised. As research progresses, the manipulation of AIP through recombinant technology continues to highlight its importance in both fundamental biology and clinical applications, underscoring the necessity of understanding protein behavior in therapeutic contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US