Cat: PA1000-93DB

Recombinant Human AIF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AIF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AIF1;G1;IBA1;;Allograft inflammatory factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55008

  • Expression Region

    1-147aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSQTRDLQGGKAFGLLKAQQEERLDEINKQ FLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVP KTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKARE KEKPTGPPAKKAISELP

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AIF1, or Allograft Inflammatory Factor 1, is a protein that plays a pivotal role in inflammatory responses and immune regulation, particularly in the context of allograft rejection and autoimmune diseases. It is predominantly expressed in macrophages and microglia, where it is involved in various cellular processes such as migration, activation, and the modulation of inflammatory responses. Research has shown that AIF1 is upregulated in pathological conditions, highlighting its potential as a biomarker for inflammatory diseases and a target for therapeutic interventions. Studies have indicated that AIF1 can influence the polarization of macrophages, shifting them towards a pro-inflammatory state, which further implicates it in the pathogenesis of chronic inflammatory conditions. Given its importance in both the immune response and disease mechanisms, AIF1 has garnered significant interest in the field of biomedical research. Efforts to engineer recombinant AIF1 (rAIF1) have paved the way for elucidating the protein's functions and therapeutic potential. Enhanced understanding of AIF1's structure and function may allow for the development of novel strategies to modulate immune responses, providing insights that could lead to innovative treatments for a variety of inflammatory and degenerative diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US