Analytical Data
-
Gene name
TARC
- Application
-
Alternative Names
TARC；SCYA17；TARC；C-C motif chemokine 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92583
-
Expression Region
24-94aa
-
AA Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS
-
Molecular Weight
81 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TARC (Thymus and Activation-Regulated Chemokine), also known as CCL17, is a chemokine involved in immune responses and the recruitment of T cells to sites of inflammation. Its role in various diseases, including asthma, allergies, and cancer, has drawn significant research interest. TARC's overexpression in these conditions highlights its potential as a biomarker for disease severity and therapeutic target. The study of TARC recombinant proteins has gained momentum as researchers seek to understand its molecular mechanisms and interactions within the immune system. By expressing TARC in a recombinant system, scientists can produce large quantities of the protein for functional assays, structural studies, and potential therapeutic applications. Furthermore, understanding the structure-function relationship of TARC can aid in the development of targeted therapies that modulate its activity, providing new insights into treating immunological disorders. The exploration of TARC-recombinant proteins not only enhances our comprehension of its biological significance but also opens avenues for innovative treatments that harness the chemokine's properties in modulating immune responses.
