Cat: PA1000-76DB

Recombinant Human ADRM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADRM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADRM1;GP110;Proteasomal ubiquitin receptor ADRM1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16186

  • Expression Region

    1-407aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMTTSGALFPSLVPGSRGASNKYLVEF RAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIF PDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNE YLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAG LGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTR ATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNV PAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADE IQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEA FAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADRM1, also known as Acidic Dipeptidase and Regulator of Mitochondrial Apoptosis 1, is a protein implicated in various cellular processes, including apoptosis, mitochondrial function, and stress responses. The role of ADRM1 in regulating the cellular stress response makes it a significant focus of research, particularly in the context of cancer and neurodegenerative diseases where mitochondrial dysfunction is a hallmark. Studies have shown that ADRM1 contributes to the regulation of proteasomal activity and protein homeostasis, which are crucial for maintaining cellular health. Additionally, its involvement in apoptosis signaling pathways suggests that ADRM1 may serve as a potential therapeutic target. Advances in recombinant protein technology allow for the production and purification of ADRM1, facilitating detailed studies into its structure, function, and interactions within cells. Understanding the functional implications of ADRM1 and its role in disease mechanisms could lead to novel therapeutic strategies aimed at modulating its activity to promote cell survival or induce apoptosis in cancer cells. As a result, the research around ADRM1 recombinant proteins has gained momentum, offering promising insights that bridge the gap between fundamental biology and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US