Cat: PA1000-50DB

Recombinant Human ACTR3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACTR3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACTR3;ARP3;Actin-related Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61158

  • Expression Region

    1-418aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAGRLPACVVDCGTGYTKLGYAGNTEP QFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWP IRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTA EIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHV IPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAV KERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFL GPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTM FRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAV WFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACTR3, also known as ARP3, is a key component of the ARP2/3 complex, which plays a vital role in the regulation of the actin cytoskeleton. The actin cytoskeleton is essential for various cellular processes, including cell motility, division, and maintenance of shape. The ARP2/3 complex is responsible for promoting the nucleation of new actin filaments, thereby facilitating the formation of branched actin networks. Dysregulation of actin dynamics is associated with several diseases, including cancer metastasis and neurodegenerative disorders. Research on ACTR3's recombinant protein focuses on its structural and functional properties, enabling scientists to understand the mechanisms by which the ARP2/3 complex interacts with actin filaments. Additionally, elucidating the role of ACTR3 in cellular processes can provide insights into potential therapeutic targets for diseases rooted in actin dysfunction. The study of recombinant ACTR3 involves techniques such as X-ray crystallography and cryo-electron microscopy, helping to detail its interactions with other proteins and actin. Given its importance in numerous cellular functions and disease contexts, ACTR3 remains a significant target of investigation in cell biology and biophysics, contributing to our understanding of cytoskeletal dynamics and potential interventions in actin-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US