Cat: PA1000-49DB

Recombinant Human ACTN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACTN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACTN1;Alpha-actinin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12814-3

  • Expression Region

    1-249aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEFMDHYDSQQTNDYMQPEEDWDRDLLL DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGE RLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKD GLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAE DIVGTARPDEKAIMTYVSSFYHAF

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACTN1, or alpha-actinin-1, is a pivotal actin-binding protein that plays a crucial role in the organization of the cytoskeleton, muscle contraction, and signal transduction. It is predominantly expressed in striated muscles, where it contributes to the structural integrity of sarcomeres by cross-linking actin filaments. Mutations in the ACTN1 gene have been linked to various myopathies, highlighting its significance in muscle health and function. Recent studies have focused on the recombinant expression of ACTN1 to elucidate its biophysical properties, interaction dynamics with other sarcomeric proteins, and its role in muscle diseases. Understanding the structural and functional aspects of ACTN1 at a molecular level can provide insights into the pathogenesis of myopathies associated with its dysfunction. The use of recombinant protein techniques allows researchers to produce large quantities of ACTN1 for biochemical assays and structural studies, thereby advancing our knowledge of muscle biology and offering potential therapeutic avenues for ACTN1-related disorders. Enhanced comprehension of this protein's attributes and interactions with actin and other cytoskeletal components will pave the way for targeted approaches in treating muscular diseases stemming from ACTN1 mutations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US