Analytical Data
-
Gene name
IGFBP1
- Application
-
Alternative Names
IGFBP1;IBP1;Insulin-like growth factor-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08833
-
Expression Region
26-259aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFAPWQCAPCSAEKLALCPPVSA SCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHA LTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEE DHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGE EISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIR GDPNCQIYFNVQN
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Insulin-like growth factor-binding protein 1 (IGFBP1) is a critical regulator of insulin-like growth factor (IGF) action, playing a significant role in cellular growth, differentiation, and metabolism. Researchers have shown that IGFBP1 is involved in various physiological processes, including fetal growth, adipogenesis, and glucose homeostasis. Its expression is closely linked to nutritional status and is often used as a biomarker for insulin sensitivity and metabolic disorders. The production of recombinant IGFBP1 has garnered interest as it allows for detailed studies on its biological functions and potential therapeutic applications. Understanding the mechanisms by which IGFBP1 regulates IGF signaling can provide insights into the pathophysiology of diseases such as obesity, diabetes, and cancer. Furthermore, recombinant IGFBP1 could serve as a tool for developing novel treatment strategies, making it a subject of extensive research in fields ranging from endocrinology to molecular biology. The advances in recombinant protein technology have facilitated the production and purification of IGFBP1, enabling scientists to explore its structure-functional relationships and interactions with IGFs and other binding partners in different biological contexts. This research is crucial for elucidating the broader implications of IGFBP1 in health and disease, ultimately contributing to the development of targeted therapeutic interventions.











