Cat: PA1000-8890

Recombinant Human NOS1AP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NOS1AP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NOS1AP;CAPON;KIAA0464;Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75052

  • Expression Region

    1-506aa

  • AA Sequence

    MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVE IVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWT WDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKK KSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGR QLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSH TGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLH SPPLGAGLADFAHPAGSPLGRRDCLVKLECFRFLPPEDTPPPAQGEALLG GLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNVLQRQELGDGL DDEIAV

  • Molecular Weight

    83 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NOS1AP, or neuronal nitric oxide synthase 1 associated protein, plays a critical role in the regulation of neuronal signaling and has been implicated in various neurological disorders. Research indicates that NOS1AP interacts with the nNOS enzyme, influencing nitric oxide production, which is crucial for neurotransmission and synaptic plasticity. The protein is encoded by the NOS1AP gene, located on chromosome 1, and variations in this gene have been associated with several psychiatric conditions, including schizophrenia and bipolar disorder. Given its significant role in the central nervous system, NOS1AP has emerged as a potential therapeutic target for treating these mental health issues. Additionally, studies have shown that the protein can affect cellular calcium signaling and contribute to neuroinflammatory processes, further complicating its role in neurobiology. Understanding the structure and function of NOS1AP through the development of recombinant proteins could provide valuable insights into its mechanisms and interactions, paving the way for targeted therapies. Recombinant protein studies help elucidate the protein’s functional domains, offering a clearer understanding of how it modulates neuronal behavior and contributes to the pathophysiology of various brain disorders. Overall, NOS1AP represents a compelling focus for research aimed at deciphering the intricate relationships between genetic factors and neurological health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US