Analytical Data
-
Gene name
ABO
- Application
-
Alternative Names
ABO；Histo-blood group ABO system transferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16442
-
Expression Region
54-354aa
-
AA Sequence
AVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABO blood group system is a critical component of human immunology, consisting of A, B, AB, and O blood types determined by specific carbohydrate antigens on the surface of red blood cells. The study of recombinant ABO glycoproteins is essential for understanding blood group antigens, their biosynthesis, and their role in transfusion medicine, organ transplantation, and disease susceptibility. These glycoproteins are implicated in immune responses, with the presence or absence of ABO antigens influencing the outcome of blood transfusions and grafts, making their characterization paramount. Advances in biotechnology, particularly in recombinant DNA technology, enable researchers to produce large quantities of ABO antigens for various applications, such as developing blood group typing reagents, studying antigen-antibody interactions, and investigating their potential roles in disease. Moreover, understanding the structural and functional properties of these proteins can aid in the design of novel therapeutic agents and enhance the safety and efficacy of blood transfusions. As such, the exploration of ABO recombinant proteins not only holds significant clinical relevance but also paves the way for innovative approaches in immunotherapy and personalized medicine.
