Analytical Data
-
Gene name
AAMDC
- Application
-
Alternative Names
AAMDC；C11orf67；Mth938 domain-containing Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H7C9
-
Expression Region
1-122aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMTSPEIASLSWGQMKVKGSNTTYKDCK VWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKV PSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AAMDC, or "aspartate aminotransferase decarboxylase," is a type of recombinant protein that has garnered significant attention in recent biomedical research due to its potential applications in therapeutic interventions and understanding various metabolic pathways. Initially identified for its role in amino acid metabolism, AAMDC is involved in the conversion of aspartate to other biologically relevant compounds, which plays a crucial role in cellular metabolism and signaling. Its dysregulation has been linked to several metabolic disorders, making it a candidate for therapeutic targeting. The recombinant production of AAMDC allows for detailed structural and functional studies, which can unveil the mechanisms underlying its physiological roles. Researchers employ various expression systems, including bacterial, yeast, and eukaryotic cells, to produce this protein in sufficient quantities for analysis. Advanced techniques such as X-ray crystallography and NMR spectroscopy are then utilized to study its structure and interactions with other molecules. Furthermore, ongoing studies aim to explore its potential in the development of novel drugs or as a biomarker for specific diseases. The overall focus on AAMDC reflects a broader trend in biotechnology and molecular biology, where understanding and manipulating protein functions can lead to significant advancements in medical therapies and diagnostics.
