Cat: PA1000-14DB

Recombinant Human AAMDC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AAMDC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AAMDC;C11orf67;Mth938 domain-containing Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H7C9

  • Expression Region

    1-122aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTSPEIASLSWGQMKVKGSNTTYKDCK VWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKV PSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AAMDC, or "aspartate aminotransferase decarboxylase," is a type of recombinant protein that has garnered significant attention in recent biomedical research due to its potential applications in therapeutic interventions and understanding various metabolic pathways. Initially identified for its role in amino acid metabolism, AAMDC is involved in the conversion of aspartate to other biologically relevant compounds, which plays a crucial role in cellular metabolism and signaling. Its dysregulation has been linked to several metabolic disorders, making it a candidate for therapeutic targeting. The recombinant production of AAMDC allows for detailed structural and functional studies, which can unveil the mechanisms underlying its physiological roles. Researchers employ various expression systems, including bacterial, yeast, and eukaryotic cells, to produce this protein in sufficient quantities for analysis. Advanced techniques such as X-ray crystallography and NMR spectroscopy are then utilized to study its structure and interactions with other molecules. Furthermore, ongoing studies aim to explore its potential in the development of novel drugs or as a biomarker for specific diseases. The overall focus on AAMDC reflects a broader trend in biotechnology and molecular biology, where understanding and manipulating protein functions can lead to significant advancements in medical therapies and diagnostics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US