Analytical Data
-
Gene name
Nectin-2/CD112
-
简介
Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL.
-
Alternative Names
Nectin-2; CD112; NECTIN2; PVRL2; HVEB; PRR2
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q0MSE5
-
Expression Region
Q32-L360
-
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDMGPL
-
Protein Length
Partial
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nectin-2, also known as CD112, is a member of the Nectin family of immunoglobulin-like cell adhesion molecules that play a crucial role in neuronal development and immune responses. As a ligand for the immune receptor DNAM-1 and associated with the activation of natural killer (NK) cells and CD8+ T cells, Nectin-2 facilitates not only cellular adhesion but also the modulation of immune responses against tumors and infections. Recent studies have highlighted its significance in the tumor microenvironment, where it can influence tumor progression and immune evasion. The recombinant production of Nectin-2/CD112 protein has garnered interest due to its potential applications in immunotherapy, especially in enhancing anti-tumor immunity. By creating an immunogenic environment, Nectin-2 holds promise as a therapeutic target for various malignancies. Moreover, understanding its structure and functional dynamics could lead to the development of novel immune modulators. As researchers explore the applications of Nectin-2 in cancer therapy, its interaction with immune cells offers valuable insights into designing strategies for improving immune checkpoint blockade and combination therapies. Thus, the study and production of recombinant Nectin-2/CD112 proteins are pivotal in advancing cancer immunotherapy and elucidating the intricate interplay between tumor cells and the immune system.
