Cat: IPD-X35234

Recombinant Human CXADR Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXADR

  • 简介

    CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCoxsackievirus and adenovirus receptor/CXADR, His ; Coxsackievirus and Adenovirus Receptor; CAR; hCAR; CVB3-Binding Protein; Coxsackievirus B-Adenovirus Receptor; HCVADR; CXADR; CAR

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78310

  • Expression Region

    L20-G237

  • AA Sequence

    LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    32.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXADR (Coxsackievirus and Adenovirus Receptor) is a crucial cell surface protein that plays a significant role in viral pathogenesis, particularly in the infections caused by coxsackieviruses and adenoviruses. It functions as a receptor, facilitating viral entry into host cells, which has implications in various diseases, including myocarditis and respiratory illnesses. Research into CXADR has gained momentum due to its potential as a therapeutic target; understanding its structural and functional properties can provide insights for developing antiviral strategies. Additionally, CXADR is involved in cell adhesion and may contribute to tissue integrity and signaling pathways, making it a subject of interest in studies related to cancer and cellular differentiation. Scientists have focused on the expression and characterization of recombinant CXADR proteins to study their interactions with viruses and other cellular molecules. By producing CXADR as a recombinant protein, researchers aim to enhance our understanding of its role in viral entry mechanisms and explore its potential use in therapeutic applications, biomarker discovery, and vaccine development. Overall, the study of CXADR and its recombinant forms is vital for advancing our knowledge of viral pathology and contributing to the development of innovative medical interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US