Analytical Data
-
Gene name
CXADR
-
简介
CXADR proteins are components of the epithelial apical junction complex and, as cell adhesion molecules, are critical for the integrity of tight junctions. CXADR Protein, Human (HEK293, His) is the recombinant human-derived CXADR protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuCoxsackievirus and adenovirus receptor/CXADR, His ; Coxsackievirus and Adenovirus Receptor; CAR; hCAR; CVB3-Binding Protein; Coxsackievirus B-Adenovirus Receptor; HCVADR; CXADR; CAR
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78310
-
Expression Region
L20-G237
-
AA Sequence
LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
-
Protein Length
Extracellular Domain
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXADR (Coxsackievirus and Adenovirus Receptor) is a crucial cell surface protein that plays a significant role in viral pathogenesis, particularly in the infections caused by coxsackieviruses and adenoviruses. It functions as a receptor, facilitating viral entry into host cells, which has implications in various diseases, including myocarditis and respiratory illnesses. Research into CXADR has gained momentum due to its potential as a therapeutic target; understanding its structural and functional properties can provide insights for developing antiviral strategies. Additionally, CXADR is involved in cell adhesion and may contribute to tissue integrity and signaling pathways, making it a subject of interest in studies related to cancer and cellular differentiation. Scientists have focused on the expression and characterization of recombinant CXADR proteins to study their interactions with viruses and other cellular molecules. By producing CXADR as a recombinant protein, researchers aim to enhance our understanding of its role in viral entry mechanisms and explore its potential use in therapeutic applications, biomarker discovery, and vaccine development. Overall, the study of CXADR and its recombinant forms is vital for advancing our knowledge of viral pathology and contributing to the development of innovative medical interventions.











