Analytical Data
-
Gene name
Cytoglobin/Histoglobin
-
简介
Cytoglobin/Histoglobin Protein plays a vital role in protecting cells from oxidative stress, potentially acting as a safeguard against cellular damage. Additionally, it participates in intracellular processes related to oxygen storage or transfer. The protein's structural integrity involves the formation of homodimers linked by disulfide linkages, emphasizing its capacity for molecular interactions and stability within the cellular environment. Cytoglobin/Histoglobin Protein, Human (His) is the recombinant human-derived Cytoglobin/Histoglobin protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuCytoglobin/Histoglobin, His; Cytoglobin; Histoglobin; HGb; Stellate Cell Activation-Associated Protein; CYGB; STAP
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWM9
-
Expression Region
M1-P190
-
AA Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
-
Protein Length
Full Length
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cytoglobin and Histoglobin are members of the globin family, which play crucial roles in oxygen transport, storage, and sensing in various biological systems. These proteins have garnered significant attention due to their potential involvement in neuroprotection and tissue repair, as well as their unique capacity to bind and regulate nitric oxide. Cytoglobin, primarily expressed in various tissues including the brain and liver, is believed to protect cells from oxidative stress and facilitate cellular signaling pathways. Histoglobin, while less characterized, is thought to be associated with non-vertebrate organisms and may have evolved different biochemical properties. The recombinant expression of these proteins in microbial or eukaryotic systems is a pivotal area of study, enabling detailed investigations into their structure-function relationships and biological roles. Understanding the mechanisms by which Cytoglobin and Histoglobin function could reveal insights into therapeutic strategies for iron homeostasis, ischemic injury, and neurodegenerative diseases. Furthermore, the development of recombinant proteins allows for the exploration of their potential applications in biotechnology and medicine, including oxygen delivery systems and as tools for studying cellular responses to hypoxia. Overall, the research surrounding Cytoglobin and Histoglobin recombinant proteins holds promise for elucidating their biological significance and advancing the fields of cell biology and biomedical research.
