Cat: IPD-X35136

Recombinant Human CADM2/IGSF4D Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CADM2/IGSF4D

  • 简介

    CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cell adhesion molecule 2; NECL-3; SynCAM 2; IGSF4D

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N3J6-2

  • Expression Region

    G30-D335

  • AA Sequence

    GSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD

  • Protein Length

    Partial

  • Molecular Weight

    40-57 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CADM2 (Cell Adhesion Molecule 2), also known as IGSF4D, is a member of the immunoglobulin superfamily and plays a crucial role in cell-cell adhesion and signaling processes. This protein is predominantly expressed in the central nervous system and has been implicated in various neuronal functions, including synaptic plasticity and the regulation of neuronal development. Research has shown that CADM2/IGSF4D is involved in the modulation of neuronal networks and has potential implications in neurological disorders such as autism spectrum disorders and schizophrenia. The study of CADM2/IGSF4D recombinant proteins provides valuable insights into their structural and functional properties, enabling researchers to explore their roles in cellular mechanisms and disease pathways. With advanced biotechnological methods, the production of these recombinant proteins facilitates the development of therapeutic strategies targeting CADM2/IGSF4D-related pathways, highlighting the significance of this research in understanding complex neurodevelopmental and psychiatric conditions. The exploration of CADM2/IGSF4D not only enhances our knowledge of cell adhesion mechanisms but also opens avenues for innovative treatment approaches for neuropsychiatric illnesses.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US