Analytical Data
-
Gene name
GPA33
-
简介
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..
- Application
-
Alternative Names
GPA33; A33
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
G7NU40-1
-
Expression Region
I38-V251
-
AA Sequence
WPVLWTLCAVRVTVNAITVETSQNVLRALHGKSVTLPCTYHTSTSSREGLIQWDKLLFTHTERVVIWQFSNKDYIYGELYKNRVNISSNVEQSDASITIDQLTMADNGTYECSVSLMSDLDGTTKSRVRLLVLLPPSKPECGIEGETIIGNDIQLTCQSKEGSPTPQYSWKRYDILNQEQPLAQPASGQPVSLKNVSTDTSGYYICTSSNEAGI
-
Protein Length
Partial
-
Molecular Weight
35-38 kDa & 40-45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPA33 is a promising biomarker and therapeutic target that has garnered significant attention in the context of cancer research, particularly in renal cell carcinoma (RCC). This protein is a transmembrane glycoprotein predominantly expressed on the surface of cancer cells, making it a potential candidate for targeted therapies. Research indicates that GPA33 plays a role in tumor progression and immune evasion, highlighting its potential as a tool for both diagnosis and treatment. With the rising incidence of RCC and the limitations of current treatment modalities, the exploration of GPA33 as a recombinant protein aims to contribute to the development of novel immunotherapeutic strategies. Targeting GPA33 could enable the delivery of therapeutic agents specifically to cancer cells, minimizing damage to healthy tissue and enhancing the efficacy of treatment. Additionally, understanding the molecular mechanisms underlying GPA33 expression and function could provide insights into RCC biology and lead to the identification of new therapeutic approaches. Overall, the study of GPA33 as a recombinant protein stands at the intersection of molecular biology and clinical oncology, holding promise for improved patient outcomes through more precise and personalized cancer therapies.
