Analytical Data
-
Gene name
SCGN
- Application
-
Alternative Names
Secretagogin; SCGN; SECRET
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76038
-
Expression Region
M1-P276
-
AA Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
-
Protein Length
Full Length
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCGN (Secretagogin) is a calcium-binding protein implicated in various physiological and pathological processes, including neuron signaling, hormone secretion, and cardiac function. Its expression is markedly elevated in neuroendocrine tissues, suggesting a role in the regulation of neurotransmitter release and cellular communication. In recent years, research has focused on the structural and functional characterization of SCGN to better understand its mechanisms of action. Studies indicate that SCGN may be involved in the pathogenesis of several neurodegenerative diseases, such as Alzheimer's and Parkinson's, where dysregulation of calcium signaling is a key feature. Additionally, SCGN's role in the modulation of insulin secretion from pancreatic beta cells has garnered attention, linking it to metabolic disorders like type 2 diabetes. Investigating SCGN's interactions with other proteins and its regulatory pathways could provide insights into new therapeutic targets for these diseases. Moreover, the development of recombinant SCGN proteins has advanced the field, facilitating in vitro and in vivo studies to elucidate its biological functions. Overall, SCGN is emerging as a crucial player in the interplay between calcium signaling, neuroendocrine function, and disease, highlighting the need for further research into its potential as a biomarker and therapeutic target.











