Analytical Data
-
Gene name
P-Selectin
- Application
-
Alternative Names
P-selectin; GMP-140; LECAM3; PADGEM; CD62P; Selp
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_001094728.1
-
Expression Region
W42-A771
-
AA Sequence
WTYHYSTKAYSWNTSRKYCQNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA
-
Protein Length
Partial
-
Molecular Weight
115 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P-Selectin, a cell adhesion molecule predominantly expressed on activated endothelial cells and platelets, plays a crucial role in the inflammatory response and thrombosis. The protein is part of the selectin family, which facilitates the rolling of leukocytes on the endothelium during inflammation and tissue repair. Its interaction with specific carbohydrates on leukocytes initiates their recruitment to sites of injury or inflammation. Given its significant involvement in various pathological conditions, including cardiovascular diseases, autoimmune disorders, and cancer metastasis, P-Selectin has emerged as a promising therapeutic target. Researchers have focused on the development of recombinant P-Selectin proteins for studying its structure and function, as these proteins allow for detailed investigations into its binding kinetics and molecular interactions. Such studies are essential for understanding how P-Selectin mediates cell adhesion and signaling. Moreover, recombinant P-Selectin can serve as a basis for creating antagonists or inhibitors that might reduce unwanted inflammatory responses or thrombosis, thus paving the way for novel therapeutic strategies in treating diseases linked to P-Selectin activity. The ongoing research not only enhances the comprehension of P-Selectin's biological roles but also contributes to the potential development of targeted therapies that could improve patient outcomes in various inflammatory and thrombotic conditions.











