Cat: IPD-X34840

Recombinant Human P-Selectin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    P-Selectin

  • 简介

    P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-selectin Protein, Human (HEK293, His) is the recombinant human-derived P-selectin protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 14.18 μg/mL, corresponding to a specific activity is 70.5219 units/mg. 2.Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce >50% adhesion on U937 cells (100 µL/well at 1 x 106cells/mL). Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells.The ED50 for this effect is 14.18 μg/mL, corresponding to a specific activity is 70.5219 units/mg.

  • Alternative Names

    P-selectin; CD62 antigen-like family member P; Granule membrane protein 140; GMP-140; Leukocyte-endothelial cell adhesion molecule 3; LECAM3; PADGEM

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P16109

  • Expression Region

    W42-A771

  • AA Sequence

    WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    95-130 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

P-Selectin, a cell adhesion molecule predominantly expressed on activated endothelial cells and platelets, plays a crucial role in the inflammatory response and thrombosis. The protein is part of the selectin family, which facilitates the rolling of leukocytes on the endothelium during inflammation and tissue repair. Its interaction with specific carbohydrates on leukocytes initiates their recruitment to sites of injury or inflammation. Given its significant involvement in various pathological conditions, including cardiovascular diseases, autoimmune disorders, and cancer metastasis, P-Selectin has emerged as a promising therapeutic target. Researchers have focused on the development of recombinant P-Selectin proteins for studying its structure and function, as these proteins allow for detailed investigations into its binding kinetics and molecular interactions. Such studies are essential for understanding how P-Selectin mediates cell adhesion and signaling. Moreover, recombinant P-Selectin can serve as a basis for creating antagonists or inhibitors that might reduce unwanted inflammatory responses or thrombosis, thus paving the way for novel therapeutic strategies in treating diseases linked to P-Selectin activity. The ongoing research not only enhances the comprehension of P-Selectin's biological roles but also contributes to the potential development of targeted therapies that could improve patient outcomes in various inflammatory and thrombotic conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US