Cat: IPD-X26773

Recombinant Mouse Thrombospondin-2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Thrombospondin-2

  • 简介

    Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Thbs2; Tsp2; Thrombospondin-2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q03350

  • Expression Region

    G19-A232

  • AA Sequence

    GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

  • Protein Length

    Partial

  • Molecular Weight

    30 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Thrombospondin-2 (TSP-2) is a matrix glycoprotein belonging to the thrombospondin family, which plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis. It is predominantly expressed in the extracellular matrix of connective tissues and is involved in tissue remodeling and wound healing. Recent studies have revealed that TSP-2 is also implicated in modulating inflammatory responses and influencing tumor progression, making it a significant target for research in cancer biology and cardiovascular diseases. The recombinant form of TSP-2 has been developed to further investigate its biological functions and therapeutic potentials. By producing TSP-2 in a controlled, recombinant system, researchers aim to study its interactions with other extracellular matrix components and signaling pathways. These investigations can provide insights into its role in disease mechanisms and identify potential therapeutic applications, such as enhancing tissue repair, inhibiting tumor growth, or regulating the immune response. Understanding TSP-2’s multifaceted roles could lead to novel strategies in treating various pathologies linked to aberrant angiogenesis and tissue remodeling, thereby offering promising avenues for developing targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US