Analytical Data
-
Gene name
NXPH1
-
简介
The NXPH1 protein is similar to a neuropeptide, acting as a signaling molecule and acting as a ligand for alpha-neurotoxins.Its role in cell signaling, influencing neural communication through alpha-neurotoxin interactions, highlights its involvement in complex molecular processes and suggests that it plays a key role in regulating cellular functions in neurobiology.NXPH1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL). The IC50 for this effect is 0.09541 μg/mL. Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL) .The IC50 for this effect is 0.09541 μg/mL.
-
Alternative Names
Neurexophilin-1; NXPH1; NPH1
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q61200
-
Expression Region
A22-G271
-
AA Sequence
ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
40-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NXPH1 (Neurexophilin 1) is a member of the neurexophilin family, which plays a crucial role in synaptic transmission and neural development. The protein is primarily expressed in the central nervous system and is believed to interact with presynaptic proteins, influencing neurotransmitter release and synaptic plasticity. Recent studies suggest that NXPH1 may be involved in various neurological disorders, including autism spectrum disorders and schizophrenia, making it a target of interest for both basic research and potential therapeutic interventions. The expression and functional characterization of recombinant NXPH1 protein are essential for understanding its biological roles and interactions with other synaptic proteins. By generating and studying this recombinant protein, researchers aim to elucidate the molecular mechanisms underlying its function in neuronal communication and its implications in neurodevelopmental and psychiatric conditions. This research not only contributes to our understanding of synaptic biology but also has the potential to inform the development of novel therapeutic strategies for treating neurological disorders associated with dysregulation of synaptic function.
