Cat: IPD-X34262

Recombinant Rat EphA2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ephrin type-A receptor 2; Epithelial cell kinase; EPHA2; ECK

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    D3ZBN3

  • Expression Region

    Q24-M536

  • AA Sequence

    QGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDAQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACQACSPGFFKSEASESPCLQCPEHTLPSTEGATSCQCEEGYFRAPEDPLSMPCTRPPSAPHYLTAIGMGAKVELRWTAPQDTGGRKDIVYSVTCEQCWPESGECGSCEASVQYSEPPQALTRTSVTVSDLEPHMNYTFTVEARNGVSDLVNSRSFRTASVSINQTEPPKVRLEDRSTTSLSVAWSIPVPQQSRVWKYEVTYRKKGDANSYNVHRTDGFSVTLDGLAPGTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSATM

  • Protein Length

    Partial

  • Molecular Weight

    60-67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphA2 is a receptor tyrosine kinase that plays a crucial role in various biological processes, including cell adhesion, migration, and differentiation. It is predominantly expressed in epithelial cells and has been implicated in several pathological conditions, particularly in cancer progression and metastasis. Abnormal EphA2 expression has been linked to tumor development and poor prognosis in various cancers, making it a potential therapeutic target. The study of EphA2 recombinant proteins is vital for understanding its functional roles and interactions at the molecular level. Researchers aim to develop EphA2-based biomarkers and therapeutic strategies by employing recombinant protein technology, which allows for the production of large quantities of purified protein for functional assays, crystallography, and structural biology studies. Investigating the structure and function of EphA2 can reveal insights into its signaling pathways and may lead to the identification of innovative treatments that inhibit its pro-tumorigenic effects. Additionally, recombinant EphA2 proteins can serve as valuable tools in the development of targeted therapies, including monoclonal antibodies and small molecule inhibitors, further advancing cancer treatment modalities. Thus, research into EphA2 recombinant proteins is critical for both basic and applied sciences, aimed at translating these findings into clinical benefits for patients with EphA2-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US