Cat: IPD-X26528

Recombinant Human Annexin A5/ANXA5 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Annexin A5/ANXA5

  • 简介

    Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.1537 μg/mL. Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.1537 μg/mL. Corresponding to a specific activity is 6506.181 units/mg.

  • Alternative Names

    rHuAnnexin A5; ANXA5; Annexin A5; Annexin V; Calphobindin I (CPB-I); Endonexin II; Anchorin CII; ANX5; ENX2; PP4

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P08758

  • Expression Region

    A2-D320

  • AA Sequence

    AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    33.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Annexin A5 (ANXA5) is a member of the annexin family of proteins, which are known for their ability to bind to phospholipids in a calcium-dependent manner. This protein plays a crucial role in various cellular processes, including apoptosis, cell migration, and membrane repair. The study of recombinant ANXA5 has garnered significant interest due to its potential applications in both basic research and clinical settings. In cellular contexts, ANXA5 is often implicated in the prevention of apoptosis and the modulation of inflammatory responses, making it a valuable target for therapeutic interventions in diseases such as cancer, cardiovascular disorders, and neurodegenerative conditions. The generation of recombinant ANXA5 allows researchers to investigate its biochemical properties, functional mechanisms, and interactions with other cellular components in detail. Furthermore, the use of recombinant protein technology has facilitated the production of modified forms of ANXA5, enhancing its properties for use in diagnostics and therapeutics. With ongoing research, ANXA5 continues to emerge as a promising biomarker and target for novel therapeutic strategies, underscoring the need for a deeper understanding of its biological functions and the development of effective applications in medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US