Cat: IPD-X26296

Recombinant Mouse SLC30A8 Protein (E. coli Cell-free),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC30A8

  • 简介

    SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Proton-coupled zinc antiporter SLC30A8; Solute carrier family 30 member 8; Zinc transporter 8; ZnT-8

  • Species

    Mouse

  • Source

    E. coli Cell-free

  • Tag

    N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8BGG0

  • Expression Region

    M1-D367

  • AA Sequence

    MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

  • Protein Length

    Full Length

  • Molecular Weight

    Monomer: 43 kDa Dimer: 86 kDa It is speculated that the protein forms a dimeric structure.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC30A8, a member of the SLC (solute carrier) family, encodes a zinc transporter predominantly expressed in pancreatic beta cells, where it plays a crucial role in insulin secretion and glucose homeostasis. Genetic studies have identified SLC30A8 as a significant risk factor for type 2 diabetes, with certain polymorphisms associated with increased susceptibility to the disease. The protein facilitates the transport of zinc ions, which are essential for insulin crystallization and storage within secretory granules. Understanding the functional mechanisms of SLC30A8 and its influence on beta-cell function is vital for elucidating the pathophysiology of diabetes. Research has increasingly focused on the recombinant expression of SLC30A8 to explore its structure-function relationships, enabling the investigation of how specific mutations might affect protein activity. Recent advances in techniques such as X-ray crystallography and cryo-electron microscopy have provided insights into its molecular architecture, further guiding therapeutic interventions. By studying the recombinant protein in various cellular contexts, researchers aim to identify potential targets for drug development, paving the way for novel strategies to combat type 2 diabetes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US