Cat: IPD-X26291

Recombinant Mouse ATP1B1 Protein (E. coli Cell-free),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ATP1B1

  • 简介

    The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1

  • Species

    Mouse

  • Source

    E. coli Cell-free

  • Tag

    N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14094

  • Expression Region

    M1-S304

  • AA Sequence

    MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

  • Protein Length

    Full Length

  • Molecular Weight

    Monomer: 35 kDa Dimer: 70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ATP1B1, a gene encoding the beta subunit of the Na+/K+ ATPase, plays a crucial role in maintaining cellular ion homeostasis and facilitating electrical excitability in various tissues, including the heart and brain. Mutations in ATP1B1 have been linked to several pathophysiological conditions, notably familial hemiplegic migraine and certain forms of congenital heart disease, highlighting its significance in human health. Research on ATP1B1 recombinant protein is vital for understanding its structure-function relationships, elucidating the molecular mechanisms behind ion transport, and exploring its role in disease mechanisms. The production of ATP1B1 recombinant protein allows for detailed biochemical characterization, functional assays, and the development of potential therapeutic strategies targeting its functionality. Additionally, studying ATP1B1 in a recombinant form facilitates high-throughput screening for drug interactions, which could lead to novel interventions for related disorders. Overall, these studies could contribute significantly to the fields of ion channel research, neurobiology, and cardiovascular medicine, providing insights that may translate into better clinical outcomes for patients suffering from ATP1B1-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US