Analytical Data
-
Gene name
ATP1B1
-
简介
The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Application
-
Alternative Names
Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
-
Species
Mouse
-
Source
E. coli Cell-free
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14094
-
Expression Region
M1-S304
-
AA Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS
-
Protein Length
Full Length
-
Molecular Weight
Monomer: 35 kDa Dimer: 70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP1B1, a gene encoding the beta subunit of the Na+/K+ ATPase, plays a crucial role in maintaining cellular ion homeostasis and facilitating electrical excitability in various tissues, including the heart and brain. Mutations in ATP1B1 have been linked to several pathophysiological conditions, notably familial hemiplegic migraine and certain forms of congenital heart disease, highlighting its significance in human health. Research on ATP1B1 recombinant protein is vital for understanding its structure-function relationships, elucidating the molecular mechanisms behind ion transport, and exploring its role in disease mechanisms. The production of ATP1B1 recombinant protein allows for detailed biochemical characterization, functional assays, and the development of potential therapeutic strategies targeting its functionality. Additionally, studying ATP1B1 in a recombinant form facilitates high-throughput screening for drug interactions, which could lead to novel interventions for related disorders. Overall, these studies could contribute significantly to the fields of ion channel research, neurobiology, and cardiovascular medicine, providing insights that may translate into better clinical outcomes for patients suffering from ATP1B1-related diseases.











