Recombinant Human Cardiotrophin-1/CTF1 Protein(HEK293), N-hFc

Cardiotrophin-1/CTF1

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with N-hFc labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is typically 0.001-0.06 μg/mL. Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 1.052 ng/mL, corresponding to a specific activity is 9.505×10^5 units/mg.

Cardiotrophin-1; CT-1; CTF1

Human

HEK293

N-hFc

Greater than 90% as determined by reducing SDS-PAGE.

Q16619

S2-A201

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Partial

54&37 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.