Cat: IPD-X30473

Recombinant Human Sialidase-1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Sialidase-1

  • 简介

    The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Sialidase-1; Acetylneuraminyl Hydrolase; G9 Sialidase; Lysosomal Sialidase; N-Acetyl-Alpha-Neuraminidase 1; NEU1; NANH

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99519

  • Expression Region

    E48-L415

  • AA Sequence

    ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    39-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Sialidase-1, also known as neuraminidase-1 (NEU1), is an important enzyme that catalyzes the removal of sialic acid residues from glycoconjugates, playing a crucial role in cellular processes such as cell signaling, pathogen recognition, and immune responses. Mutations or deficiencies in the NEU1 gene are linked to sialidosis and other lysosomal storage disorders, which can lead to severe neurological symptoms, developmental delays, and other metabolic issues. Research on recombinant Sialidase-1 protein focuses on its biosynthesis, structural characterization, and functional analysis to understand its role in various biological processes and disease mechanisms. The production of recombinant NEU1 provides an opportunity for therapeutic applications, including enzyme replacement therapy, to alleviate symptoms associated with NEU1 deficiencies. Recent advancements in protein engineering and expression systems have facilitated the development of highly active and stable recombinant forms of the enzyme, paving the way for potential clinical interventions. Additionally, understanding the enzymatic mechanisms and substrate specificity of sialidase-1 may lead to innovative strategies for targeting diseases related to glycan metabolism and provide insights into the broader implications of sialylation in health and disease. Overall, ongoing research aims to harness the therapeutic potential of recombinant Sialidase-1 in treating sialidosis and other related conditions while advancing our understanding of the critical roles that sialic acid plays in cellular functions and pathogenicity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US