Cat: IPD-X30470

Recombinant Human PPT1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPT1

  • 简介

    PPT1 (palmitoyl protein thioesterase 1) crucially promotes lysosomal degradation by specifically removing thioester-linked fatty acyl groups, especially palmitate, from modified cysteine residues in proteins. Its enzymatic activity is particularly suited to acyl chain lengths of 14 to 18 carbons, facilitating the breakdown of target proteins during lysosomal degradation. PPT1 Protein, Human (HEK293, His) is the recombinant human-derived PPT1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Palmitoyl-protein thioesterase 1; PPT-1; Palmitoyl-protein hydrolase 1; PPT1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P50897-1

  • Expression Region

    D28-G306

  • AA Sequence

    DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    34-41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PPT1 (palmitoyl-protein thioesterase 1) has gained significant attention due to its critical role in the pathogenesis of neurodegenerative disorders, particularly Batten disease, a severe childhood neurodegeneration caused by genetic mutations in the PPT1 gene. PPT1 is an enzyme responsible for the removal of palmitate from proteins, a post-translational modification that influences membrane localization, protein stability, and cellular signaling. Deficiencies in PPT1 activity lead to the accumulation of palmitoylated proteins in neuronal cells, contributing to cellular dysfunction and neurodegeneration. Research into PPT1 has focused on understanding its enzymatic mechanisms, substrate specificity, and the biochemical pathways affected by its deficiency. Additionally, therapeutic strategies, including gene therapy, small molecule compounds, and enzyme replacement therapies, are being explored to restore PPT1 function and mitigate the progression of associated neurodegenerative diseases. As advances are made in elucidating PPT1's biological roles and interactions, the findings hold promise for developing novel approaches to treat or even prevent the onset of disorders linked to PPT1 deficiency, underscoring the importance of continued research in this field.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US