Cat: IPD-X26089

Recombinant Human SPG21 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPG21

  • 简介

    The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Maspardin; Acid cluster protein 33; ACP33; BM-019; GL010; Spastic paraplegia 21 protein

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9NZD8-1

  • Expression Region

    M1-Q308

  • AA Sequence

    MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPG21, also known as Spastic Paraplegia 21, is a gene associated with hereditary spastic paraplegia (HSP), a group of neurodegenerative disorders characterized by progressive weakness and stiffness of the lower limbs. The SPG21 gene encodes a protein called spatacsin, which is believed to play a crucial role in maintaining neuronal function and membrane integrity. Mutations in the SPG21 gene lead to the accumulation of damaged organelles and impaired autophagy, ultimately resulting in neurodegeneration and clinical symptoms of HSP. Research into the structure and function of SPG21 recombinant protein is essential for understanding the underlying mechanisms of the disease and developing potential therapeutic strategies. Scientists have been focusing on producing and characterizing SPG21 recombinant protein to investigate its interactions with other cellular components and its role in cellular processes. By utilizing advanced techniques such as X-ray crystallography and cryo-electron microscopy, researchers aim to elucidate the protein's three-dimensional structure and gain insights into how specific mutations affect its functionality. Understanding these molecular details is crucial for uncovering the pathophysiology of HSP caused by SPG21 mutations and may pave the way for targeted treatments, such as gene therapy or small molecules that can modulate the cellular pathways affected by spatacsin dysfunction. Therefore, the study of SPG21 recombinant protein not only enhances our comprehension of hereditary spastic paraplegia but also represents a promising avenue for future research and therapeutic intervention in this debilitating condition.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US